PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D09G1026
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 484aa    MW: 53483.6 Da    PI: 4.8009
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D09G1026genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding582.2e-182875148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +lvd+vk++G g+W+++ ++ g+ R++k+c++rw ++l
      Gh_D09G1026 28 KGPWTSAEDAILVDYVKKHGEGNWNAVQKHSGLSRCGKSCRLRWANHL 75
                     79******************************************9986 PP

2Myb_DNA-binding51.42.5e-1681124146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g +T+eE+ ++v+++++lG++ W++ a++++ gRt++++k++w++
      Gh_D09G1026  81 KGMFTPEEERRIVELHAKLGNK-WARMAAELP-GRTDNEIKNFWNT 124
                      6789******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.6372375IPR017930Myb domain
SuperFamilySSF466894.12E-3026122IPR009057Homeodomain-like
SMARTSM007171.2E-152777IPR001005SANT/Myb domain
PfamPF002497.2E-162875IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-242982IPR009057Homeodomain-like
CDDcd001676.83E-123075No hitNo description
PROSITE profilePS5129424.83276130IPR017930Myb domain
SMARTSM007172.5E-1480128IPR001005SANT/Myb domain
PfamPF002495.9E-1581124IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2483128IPR009057Homeodomain-like
CDDcd001671.33E-1184124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 484 aa     Download sequence    Send to blast
MRKGQSDFSL VEEAGRRGNM RESCHLKKGP WTSAEDAILV DYVKKHGEGN WNAVQKHSGL  60
SRCGKSCRLR WANHLRPDLK KGMFTPEEER RIVELHAKLG NKWARMAAEL PGRTDNEIKN  120
FWNTRIKRLQ RAGLPIYPPD VCLQVNLSQE ESHSVASMPN LDSFGSNLVQ SDAFGIPHVE  180
FENLELNQQF LSYSPELLNI PPKTIGLSHG YGHVFPMACP PKHLQESVSN YMSLPNQMTD  240
FACKENFDEP YKSSSPYDSD FSTNDQSSFG IPPGSDALLN SNFSPSEPLS GPMNLELPSY  300
QYSDNQQDSW VNSSVPLALV ESVDTLIQSP PMKRAKSECF ALQNSGLLEA VLYESKKLNS  360
SKDDSRQQSS NLMLDDVADF HLKDCELEFE AHCDPNSPSA LSAASVLSEH TPVSGSSLDD  420
ESQFVESILG GNGKNETPNQ MAISGLDDFL GRGQFGHDNG CVNDKPIVTD VIAALLGEDA  480
CCGY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-32261285106B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012485272.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_012485273.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_012485274.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_012485275.10.0PREDICTED: transcription factor GAMYB-like
SwissprotQ0JIC24e-93GAM1_ORYSJ; Transcription factor GAMYB
TrEMBLA0A0D2RUT70.0A0A0D2RUT7_G
STRINGPOPTR_0009s02380.11e-155(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM91982138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.13e-84myb domain protein 65